PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0030s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Trihelix
Protein Properties Length: 621aa    MW: 69167.2 Da    PI: 6.9064
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0030s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.62.3e-3070155187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW++qe+laL+++r++m+ ++r+++lk+plW++vs+km+e g++rs+k+Ckek+en+ k++k++++g++++ s+ ++t+++fd+lea
  Kaladp0030s0014.1.p  70 RWPRQETLALLKIRSDMDLAFRDSNLKGPLWDDVSRKMAELGYHRSAKKCKEKFENVYKYHKRTRDGRSSK-SDGKKTYRFFDELEA 155
                          8*********************************************************************8.66667*******985 PP

2trihelix94.78.6e-30427511186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW+k ev aLi++r++ e +++++  k+p Wee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++k+r +++s+tcpy++ l+
  Kaladp0030s0014.1.p 427 RWPKAEVEALIKLRTSFEIKYQENGPKGPFWEEISAGMSSLGYNRNAKRCKEKWENINKYFKKVKESNKQR-PQASKTCPYYHLLD 511
                          8********************************************************************98.999********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0167129IPR001005SANT/Myb domain
PfamPF138371.5E-2069156No hitNo description
PROSITE profilePS500906.64470127IPR017877Myb-like domain
CDDcd122033.49E-2470134No hitNo description
SMARTSM007170.0014424486IPR001005SANT/Myb domain
PfamPF138373.0E-21426513No hitNo description
CDDcd122031.93E-25426491No hitNo description
PROSITE profilePS500907.166426484IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.3E-4426483IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MLGGGGGGGG ASVAMLVSSC QESGGDKAAS HDPNNNCSLA GVFGEEEINN ARNGNSMEDG  60
DRNSGGSSHR WPRQETLALL KIRSDMDLAF RDSNLKGPLW DDVSRKMAEL GYHRSAKKCK  120
EKFENVYKYH KRTRDGRSSK SDGKKTYRFF DELEALDQLQ PFQVPPPLQQ RQQVSSHLKA  180
PPFPMQPPPA PLALQIPTAT TISFSQLPCR NSDINNPIST AAPITPAPTN PTTIISPHFQ  240
STATNFMLST SSSTSSDDFQ QRRRTEKKRK WKDFFEKLMR DVVDKQEELQ NKFLRTIEMR  300
ERDRSMREEA WRMQEMARLN REHDILVQER SAAAAKDAAI IAFLQKIAGQ QQPQTQPPSP  360
QPKPQPPPHT IIQLDPSSTP PPPQPQPQPQ PQPQPKPLSV MKPDSNASGD QNNLTMVCGS  420
TLPSSSRWPK AEVEALIKLR TSFEIKYQEN GPKGPFWEEI SAGMSSLGYN RNAKRCKEKW  480
ENINKYFKKV KESNKQRPQA SKTCPYYHLL DAIYKEKKGG GGDNDNFLPP PSANFSMEPL  540
MVQPEQQWPL APQAQARHNE DEEQDDMLDE DELEQDMEDE REDGKEENNG GTYEVVATAS  600
NKAQHGASAA TGSLGATAVA *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1260269QRRRTEKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618661.11e-168PREDICTED: trihelix transcription factor GTL1-like
TrEMBLK4DFY21e-166K4DFY2_SOLLC; Uncharacterized protein
STRINGSolyc12g056510.1.11e-166(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-68Trihelix family protein